Chemical Component Summary

Name2-NONYL-4-HYDROXYQUINOLINE N-OXIDE
Identifiers2-nonyl-1-oxido-quinolin-1-ium-4-ol
FormulaC<sub>18</sub> H<sub>25</sub> N O<sub>2</sub>
Molecular Weight287.40
TypeNON-POLYMER
Isomeric SMILESCCCCCCCCCc1cc(O)c2ccccc2[n+]1[O-]
InChIInChI=1S/C18H25NO2/c1-2-3-4-5-6-7-8-11-15-14-18(20)16-12-9-10-13-17(16)19(15)21/h9-10,12-14,20H,2-8,11H2,1H3
InChIKeyLMBFBUICIQJLPK-UHFFFAOYSA-N

Chemical Details

Formal Charge0
Atom Count46
Chiral Atom Count1
Chiral AtomsC2
Bond Count47
Aromatic Bond Count11
Leaving Atomsn/a

Drug Info: DrugBank

DrugBank IDDB08453 Different stereochemistry
Name2-NONYL-4-HYDROXYQUINOLINE N-OXIDE
Groupsexperimental

Drug Targets

NameSequence SearchPharmacological ActionActions
Cytochrome fMRNSCKKARRTRPLKATIQALLVAIATMTFFFTSDIALPQSAAAYPFWAQ...unknown
Cytochrome b-c1 complex subunit Rieske, mitochondrialMLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL...unknown
Cytochrome b-c1 complex subunit 7MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRR...unknown
Cytochrome b6-f complex subunit 5MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGGunknown
Cytochrome b-c1 complex subunit 9MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEG...unknown
View More
Drug Info/Drug Targets: DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Knox C, Law V, Jewison T, Liu P, Ly S, Frolkis A, Pon A, Banco K, Mak C, Neveu V, Djoumbou Y, Eisner R, Guo AC, Wishart DS. Nucleic Acids Res. 2011 Jan; 39 (Database issue):D1035-41. | PMID:21059682