this piece corresponds to the legacy myPDB login in the form of a bootstrap modal, will likely retire-->



QNO is found in 3 entries

QNO as free ligands, exist in 3 entries. Example includes: 2E75 1NU1 4H0L

Find related ligands: Stereoisomers Similar ligands Chemical Structure Search

View summary at Ligand Expo

Chemical Component Summary

FormulaC18 H25 N O2
Molecular Weight287.40 g/mol
Isomeric SMILESCCCCCCCCCc1cc(O)c2ccccc2[n+]1[O-]

Chemical Details

Formal Charge0
Atom Count46
Chiral Atom Count1
Chiral AtomsC2
Bond Count47
Aromatic Bond Count11
Leaving Atomsn/a

Drug Info: DrugBank

DrugBank IDDB08453 Stereoisomeric match

Drug Targets

NameSequence SearchPharmacological ActionActions
Cytochrome b-c1 complex subunit Rieske, mitochondrialMLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL...unknown
Cytochrome b6-f complex subunit 5MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGGunknown
View More
Drug Info/Drug Targets: DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Knox C, Law V, Jewison T, Liu P, Ly S, Frolkis A, Pon A, Banco K, Mak C, Neveu V, Djoumbou Y, Eisner R, Guo AC, Wishart DS. Nucleic Acids Res. 2011 Jan; 39 (Database issue):D1035-41. | PMID:21059682