News

Simple Sequence Searching

09/13

Enter a sequence in the top search bar to search for matching PDB entities.

Sequence Searches at RCSB.org use MMseqs2 to find similar protein and nucleic acid sequences in the archive.

<I>Basic Sequence Search. Use the slider button to include Computer Structure Models in the Search Results.</I>Basic Sequence Search. Use the slider button to include Computer Structure Models in the Search Results.

For example, a search for the sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT will currently return >400 entities for exploration. Including the option for CSMs will add ~100 more examples.

<I>Search Results including PDB experimental structures and CSMs. <BR> A) Use the Refinements panel on the left to limit the results based on characteristics including Structure Determination Method and Source Organism. <BR> B) Results can be sorted using the pulldown feature on the right.</I>Search Results including PDB experimental structures and CSMs.
A) Use the Refinements panel on the left to limit the results based on characteristics including Structure Determination Method and Source Organism.
B) Results can be sorted using the pulldown feature on the right.

References

News Index